Protein Info for DDA3937_RS18315 in Dickeya dadantii 3937

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase
  • amino acids 6 to 269 (264 residues), 360.9 bits, E=2.3e-112
• PF01113: DapB_N
  • amino acids 6 to 129 (124 residues), 147 bits, E=2.9e-47
• PF05173: DapB_C
  • amino acids 132 to 268 (137 residues), 162.3 bits, E=6.1e-52

Best Hits

Swiss-Prot: 86% identical to DAPB_CITK8: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 100% identity to ddd:Dda3937_01391)

MetaCyc: 85% identical to 4-hydroxy-tetrahydrodipicolinate reductase (Escherichia coli K-12 substr. MG1655)
RXN-14014 [EC: 1.17.1.8]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

See E0SH09 at UniProt or InterPro

Protein Sequence (273 amino acids)

>DDA3937_RS18315 4-hydroxy-tetrahydrodipicolinate reductase (Dickeya dadantii 3937)
MRDAQIRVAIAGAGGRMGRQLIQAALQMDGVALGAALEREDSSLLGSDAGELAGAGKTDI
TVQSSLEAVVDDFDVFIDFTRPEGTLSHLAFCRKHGKGMVIGTTGFDEQGKAAIQQAAAD
IGIVFAANFSVGVNVLLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAG
ALGRDLKQCAVYAREGYTGEREPKSIGFATIRAGDIVGEHTAMFADVGERIEITHKASSR
MTFANGAVRSALWVSSRNHGLFDMRDVLGLDDI