Protein Info for DDA3937_RS18280 in Dickeya dadantii 3937

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 249 to 266 (18 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 4 to 324 (321 residues), 121 bits, see alignment E=2.9e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01384)

Predicted SEED Role

"Exopolysaccharide production protein ExoZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SGC7 at UniProt or InterPro

Protein Sequence (356 amino acids)

>DDA3937_RS18280 acyltransferase (Dickeya dadantii 3937)
MKILSIQYLRGLAALLVVVAHNSSMLGSEWTKRIPGALGVDVFFIISGFIMTFITYHTPG
SPVAFIVKRFFRIWPVFFFVWLFSFIFVYNERSFSQMACTLYFCLQDYSQPGPTFGYSAL
GPPWTLSYEIMFYFIFSVSMYINYRYRSYICTLVFVAAMTGFQLYYNGNFNFSSQVSPDI
MVTHWWQAWIKLISNTIMFEFIAGMLLAELMIRRRINKSPCSRTVAKIAFAAAAAGAVIV
GPQVFGLSGGFWLALVIMISAIILNGNNETGNSRMLTFLGGISYSLYLVHYPVMVFLKNH
LSDSATSIERMAIFMLSIAGSILMSSVMFTWIETPSIRAGKKVAAILSVMRKPYQH