Protein Info for DDA3937_RS18205 in Dickeya dadantii 3937

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 17 to 159 (143 residues), 93.7 bits, E=8e-31

Best Hits

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 100% identity to ddd:Dda3937_01368)

MetaCyc: 34% identical to lipopolysaccharide transport system ATP-binding protein LptB (Helicobacter pylori 26695)
RXN-23614 [EC: 7.5.2.5]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

MetaCyc Pathways

• Helicobacter pylori 26695 lipopolysaccharide biosynthesis (final steps) (1/2 steps found)
• Salmonella typhimurium LT2 lipopolysaccharide biosynthesis (final steps) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

See E0SGB1 at UniProt or InterPro

Protein Sequence (231 amino acids)

>DDA3937_RS18205 ABC transporter ATP-binding protein (Dickeya dadantii 3937)
MLKASDLQVFYGLIQGLKGIDLEVNNSEIVTLIGSNGAGKTSTLNGIINLVKSTGTVGFL
NEDISHSPTHQIVRKGLALVPEGRKVFTNLTIEENLRMGAYNNPVNFTYLRDKMYALFPR
LKERRGQMAGTMSGGEQQMLAIARALMSEPVLLMLDEPSLGLAPKVVGELFSTIKQLQKE
GITILLVEQNATAALKIADRAYVLENGRIALHGPAQEILANPEVKRMYLGG