Protein Info for DDA3937_RS18005 in Dickeya dadantii 3937

Annotation: secA regulator SecM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF06558: SecM" amino acids 24 to 166 (143 residues), 189.1 bits, see alignment E=2.2e-60

Best Hits

Swiss-Prot: 52% identical to SECM_KLEP7: Secretion monitor (secM) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K13301, secretion monitor (inferred from 100% identity to ddd:Dda3937_02234)

Predicted SEED Role

"Secretion monitor precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SG68 at UniProt or InterPro

Protein Sequence (167 amino acids)

>DDA3937_RS18005 secA regulator SecM (Dickeya dadantii 3937)
MIGILNRWRQFGRRYFWPHLLLGMVAATLGLPANFTESRDASTAPNSASAISRPNVSYFN
LTDLAALKDSRRRSLFSNDFWHQHAIRTVIRHLSFAFTPPVTVVEAAEASRLHHQVLLET
LNALLTREATPHAAAASAVLAPTRFSPSHHAGLWLAQVQGIRAGPRA