Protein Info for DDA3937_RS17895 in Dickeya dadantii 3937

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 757 PF07715: Plug" amino acids 56 to 170 (115 residues), 100.8 bits, see alignment E=6.4e-33 TIGR01783: TonB-dependent siderophore receptor" amino acids 57 to 757 (701 residues), 342.1 bits, see alignment E=3.8e-106 PF00593: TonB_dep_Rec" amino acids 266 to 706 (441 residues), 167.4 bits, see alignment E=1.1e-52

Best Hits

Swiss-Prot: 66% identical to FEPA_ECOLI: Ferrienterobactin receptor (fepA) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 97% identity to ddd:Dda3937_04300)

MetaCyc: 66% identical to ferric enterobactin outer membrane transporter (Escherichia coli K-12 substr. MG1655)
RXN0-1682

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferric enterobactin and colicins B, D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFG0 at UniProt or InterPro

Protein Sequence (757 amino acids)

>DDA3937_RS17895 TonB-dependent siderophore receptor (Dickeya dadantii 3937)
MNWAADTVTTATTATNKTAANTASATTTSTTSTTSSTSAGDTMVVTAAEQTRQAPGVSVI
TAEDIAKRPPANDLSDIIRTQPGVNLTGNSSSGQRGNNRQIDIRGMGPENTLILVDGKPV
SSRNAVRYGWRGERDSRGDTNWVPSDMVERIEVLRGPAAARYGSGAMGGVINIITKQPGQ
EWHGSWNTYFNAPVHKAEGATKRTDFSLSGGLSDNLSLRLYGNLNKTQADAADINEPYKS
ARTGSYASSVPSGREGVRNKDINGVLRWDITKQQSLEFEVGSSRQGNIYAGDTQNTNTNN
YVASNYGKETNRMYRQTYAVTHRGFWDSGVSSTSYLQYERTHNTRISEGLAGGTEGIFSA
ADDYTTVKLDTLTAHSEVNIPFEAYFSQTATLGIEASDQRMTDPGSTSYDMSSTGVIAGY
NSSNRSGDIKAHTFALFAEDNVELTQSTMLTPALRFDYHSLAGSKVSPGLNLSQGLGDDF
TLKMGIAQAYKAPNLYQVNPNYMLYSRGQGCYLINGASNNCYLIGNEELKAETSVNKEIG
LEFKRNGYQAGVTYFRNDYRNKIESGLTPVGTTTNGKTNVYRWENIPRAVVEGLEGTLNV
PVSESIKWNNNITWMLRSKNKSTGDILSVTPEFTLNSTLSWQATDDLSLQSTLTWYGRQK
PKKYNYRGMAASGDELNELSPYAVVGTSATYAITKNVSVTGGVSNLFDKRQFRRGNASAG
CTVASDGSCSVINIAGAGAATYNESGRTFYMSVNTHF