Protein Info for DDA3937_RS17835 in Dickeya dadantii 3937

Annotation: D-threonate 4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 5 to 326 (322 residues), 366.7 bits, see alignment E=6.1e-114 PF04166: PdxA" amino acids 34 to 322 (289 residues), 346.5 bits, see alignment E=6.4e-108

Best Hits

Swiss-Prot: 91% identical to PDXA2_PECAS: D-threonate 4-phosphate dehydrogenase (pdxA2) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 100% identity to ddd:Dda3937_02627)

MetaCyc: 80% identical to 4-phospho-D-tetronate 3-dehydrogenase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN-18600 [EC: 1.1.1.408]

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.262

Use Curated BLAST to search for 1.1.1.262 or 1.1.1.408

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFE8 at UniProt or InterPro

Protein Sequence (326 amino acids)

>DDA3937_RS17835 D-threonate 4-phosphate dehydrogenase (Dickeya dadantii 3937)
MSKIIAVTMGDPAGIGPEIIIKSLAEGELSGAPAVVVGCVQTLRRILALGVVPQVELNEI
ARPADARFAPGVINVIDEPLADPQGLKKGVVQAQAGDLAYRCVKRATELAMAGEVHAIAT
APLNKEALHSAGHLYPGHTELLAKLTNSRDYAMVLYTDKLKVIHVTTHIALRKFLDTLNR
ERVETVIAMADTFLKRVGYQAPRIAVAGVNPHAGENGLFGDEEITIVGPSVEAMKAKGID
AYGPCPPDTVYLQAYEGQYDMVVAMYHDQGHIPLKLLGFYDGVNITAGLPFIRTSADHGT
AFDIAWTGKAKSESMAISIKLAMQLA