Protein Info for DDA3937_RS17555 in Dickeya dadantii 3937

Annotation: type I-F CRISPR-associated protein Csy3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR02566: CRISPR type I-F/YPEST-associated protein Csy3" amino acids 9 to 334 (326 residues), 453 bits, see alignment E=4e-140 PF09615: Cas_Csy3" amino acids 10 to 331 (322 residues), 492 bits, see alignment E=4.7e-152

Best Hits

Swiss-Prot: 82% identical to CSY3_PECAS: CRISPR-associated protein Csy3 (csy3) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03454)

Predicted SEED Role

"CRISPR-associated protein, Csy3 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SF90 at UniProt or InterPro

Protein Sequence (335 amino acids)

>DDA3937_RS17555 type I-F CRISPR-associated protein Csy3 (Dickeya dadantii 3937)
MAKVATTLKTASVLAFERKLANSDALMFAGNWQQEQWAPVTIQEKSVRGTISNRLKNAIS
SDPAKLDAEIQKANLQTVDVAALPFDADTLKVAFTLRVLGNLAQPSVCNDQDYQQALTEV
INGYARDQGFGVLAARYAENIASGRFLWRNRIGAEAVQVVVTHDDKRWEFNGEDHSLRQF
SQPNGALAELTHAIELALAGNDSAFFRVDAQVKLGNGQEVFPSQELVLDERARNGKSKIL
YQVNDVAAIHSQKIGNALRTVDDWHPEAAETGPIAVEPYGSVTSRGRAYRQPKDKMDFYT
LLDNWVIKGSAPAVEQQHYVIATLIRGGVFGEKGE