Protein Info for DDA3937_RS17420 in Dickeya dadantii 3937

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF00356: LacI" amino acids 3 to 48 (46 residues), 76.8 bits, see alignment 1.8e-25 PF00532: Peripla_BP_1" amino acids 60 to 279 (220 residues), 102.7 bits, see alignment E=5.2e-33 PF13407: Peripla_BP_4" amino acids 63 to 278 (216 residues), 67.2 bits, see alignment E=3.6e-22 PF13377: Peripla_BP_3" amino acids 169 to 329 (161 residues), 106 bits, see alignment E=4.8e-34

Best Hits

Swiss-Prot: 47% identical to ASCG_ECOLI: HTH-type transcriptional regulator AscG (ascG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02578)

Predicted SEED Role

"AscBF operon repressor" in subsystem Beta-Glucoside Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SEH9 at UniProt or InterPro

Protein Sequence (336 amino acids)

>DDA3937_RS17420 LacI family DNA-binding transcriptional regulator (Dickeya dadantii 3937)
MMTMLDVARHAGVSKATVSRVLNGTGQVKQSTRDAVFKAMEELGYRPNFLARSLAQRSSN
SLGLVVSNFDGPYFGRLLRRAAERTETSGKHLIVTDGHDTPEDEQQAVQLLTDRRCDAIV
LYTRHMSDAALMGLLEQSTVPIVVINRHLPMAPDRCVWFEQQQAVFQLIDYLVQQGHREI
ACITGPINTPTARARLAGYRQALDHHRIPYDPLRVVNGDNLVPGGYQAVRELLAHDAGFS
AIFASNDDMCIGAMKALLEAGKRLPQDVSLFGFDDIPSAPYLNPALSTVYLPIEEMISAA
ISQALKLSEGASVKPIAPFIGELKRRASVAQGPHTR