Protein Info for DDA3937_RS17335 in Dickeya dadantii 3937

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF13527: Acetyltransf_9" amino acids 17 to 131 (115 residues), 29.6 bits, see alignment E=1.3e-10 PF00583: Acetyltransf_1" amino acids 29 to 130 (102 residues), 46.6 bits, see alignment E=7.6e-16 PF13508: Acetyltransf_7" amino acids 49 to 131 (83 residues), 47.9 bits, see alignment E=3e-16 PF13673: Acetyltransf_10" amino acids 49 to 148 (100 residues), 55 bits, see alignment E=1.7e-18

Best Hits

Swiss-Prot: 49% identical to ELAA_ECOLI: Protein ElaA (elaA) from Escherichia coli (strain K12)

KEGG orthology group: K02348, ElaA protein (inferred from 100% identity to ddd:Dda3937_02594)

Predicted SEED Role

"ElaA protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SEG2 at UniProt or InterPro

Protein Sequence (151 amino acids)

>DDA3937_RS17335 GNAT family N-acetyltransferase (Dickeya dadantii 3937)
MSLIWHDWGVKDLNPYALYDILRLRSQVFVVEQQCAYQDADGLDLVDGNRHVTAWQNGRL
IACARLLAPHDGQDAVTIGRVVVAPEARGQQLGHQLLMHSQAACARHWPGRAQYLSAQAH
LQHFYQQFGFVVCGDGYDEDGIPHVPMRTAG