Protein Info for DDA3937_RS17180 in Dickeya dadantii 3937

Annotation: 3'(2'),5'-bisphosphate nucleotidase CysQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01331: 3'(2'),5'-bisphosphate nucleotidase
  • amino acids 1 to 244 (244 residues), 333.9 bits, E=3.3e-104
• PF00459: Inositol_P
  • amino acids 3 to 233 (231 residues), 173.5 bits, E=3.3e-55

Best Hits

Swiss-Prot: 76% identical to CYSQ_ECOLI: 3'(2'),5'-bisphosphate nucleotidase CysQ (cysQ) from Escherichia coli (strain K12)

KEGG orthology group: K03677, CysQ protein (inferred from 100% identity to ddd:Dda3937_00161)

MetaCyc: 76% identical to 3'(2'),5'-bisphosphate nucleotidase (Escherichia coli K-12 substr. MG1655)
3'(2'),5'-bisphosphate nucleotidase. [EC: 3.1.3.7]

Predicted SEED Role

"3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)" (EC 3.1.3.7)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.7

Sequence Analysis Tools

See E0SEC9 at UniProt or InterPro

Protein Sequence (246 amino acids)

>DDA3937_RS17180 3'(2'),5'-bisphosphate nucleotidase CysQ (Dickeya dadantii 3937)
MLEQICQLAREAGDAIMQVYNGQQPLNAALKKDDSPVTAADLAAHRVIARGLAEQYPETP
MLSEEDPQAWSERQHWQRYWLVDPLDGTKEFLNRNGEFTVNIALIDNGKPVLGVVYVPVT
GVMYAAADGKAWKEEDGKRRAIRVKDARPPLVVVSRSHADAELDDYLRQLGEHHTVSIGS
SLKFCLVAEGKAQLYPRFGPTNIWDTAAGHAVALAAGAQVHDWQGRSLSYLPRESFLNPG
FRVSLF