Protein Info for DDA3937_RS17050 in Dickeya dadantii 3937

Annotation: glucarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF02746: MR_MLE_N" amino acids 41 to 137 (97 residues), 30.3 bits, see alignment E=4.4e-11 PF13378: MR_MLE_C" amino acids 188 to 404 (217 residues), 166.1 bits, see alignment E=1e-52

Best Hits

Swiss-Prot: 84% identical to GUDX_ECOLI: Glucarate dehydratase-related protein (gudX) from Escherichia coli (strain K12)

KEGG orthology group: K13918, glucarate dehydratase-related protein (inferred from 100% identity to ddd:Dda3937_00188)

MetaCyc: 65% identical to D-glucarate dehydratase subunit (Pseudomonas putida)
Glucarate dehydratase. [EC: 4.2.1.40]

Predicted SEED Role

"Glucarate dehydratase (EC 4.2.1.40)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.40

Use Curated BLAST to search for 4.2.1.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDM4 at UniProt or InterPro

Protein Sequence (453 amino acids)

>DDA3937_RS17050 glucarate dehydratase (Dickeya dadantii 3937)
MSSTQDTPVITDMKVIPVAGYDSMLLNIGGAHGAYFTRNIVILTDNAGHTGVGEAPGGEV
IYNTLTAAIPQVVGAQVARMNHLVHQVHKGNQSSDFDSFGNGAWTFELRVNAVAALEAAL
LDLLGQHLNVPVAELLGPGKQRDDVTVLGYLFYIGDRTKTDLPYLEGEQGKHPWYHLRHQ
KAMDSASVVRLAEAAADRYGFKDFKLKGGVLPGELEIDAVKALKKRFPDARITVDPNGAW
LLDEAIGLCKGLNGVLTYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMNH
AVMLQSVDIPLADPHFWTMHGAVRVAQLCDEWGLTWGCHSNNHFDISLAMFTHVGAAAPG
KPTAIDTHWIWQEGQHLTKEPLQIVNGKIKVPERPGLGIELDMEQVMKAHELHKKLPSGA
RNDAAAMQYLIPGWKFDRKRPVFGRELPKNSTF