Protein Info for DDA3937_RS16905 in Dickeya dadantii 3937

Annotation: cell division protein FtsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04977: DivIC" amino acids 11 to 88 (78 residues), 103 bits, see alignment E=3.1e-34

Best Hits

Swiss-Prot: 83% identical to FTSB_PECCP: Cell division protein FtsB (ftsB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K05589, cell division protein FtsB (inferred from 100% identity to ddd:Dda3937_03905)

Predicted SEED Role

"Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDJ4 at UniProt or InterPro

Protein Sequence (112 amino acids)

>DDA3937_RS16905 cell division protein FtsB (Dickeya dadantii 3937)
MGKLSLLLLILLGWLQYSLWLGKNGVHDYVRVKDDVAVQQANNVKLKSRNEQLFAEIDDL
NGGQEAIEERARNELGMTKPGESFYRLVADPADRRVGTNPSSAPSTSSSTSR