Protein Info for DDA3937_RS16775 in Dickeya dadantii 3937

Annotation: thioredoxin TrxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF21352: Thio2_N" amino acids 4 to 32 (29 residues), 33.1 bits, see alignment 5.9e-12 PF00085: Thioredoxin" amino acids 39 to 137 (99 residues), 89.8 bits, see alignment E=1.6e-29 TIGR01068: thioredoxin" amino acids 44 to 139 (96 residues), 113.9 bits, see alignment E=1.7e-37 PF13098: Thioredoxin_2" amino acids 54 to 137 (84 residues), 36.6 bits, see alignment E=7.7e-13

Best Hits

Swiss-Prot: 74% identical to THIO2_SHIFL: Thioredoxin 2 (trxC) from Shigella flexneri

KEGG orthology group: K03672, thioredoxin 2 [EC: 1.8.1.8] (inferred from 100% identity to ddd:Dda3937_00890)

MetaCyc: 74% identical to reduced thioredoxin 2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Thioredoxin 2 (EC 1.8.1.8)" (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDH4 at UniProt or InterPro

Protein Sequence (141 amino acids)

>DDA3937_RS16775 thioredoxin TrxC (Dickeya dadantii 3937)
MNTVCASCHATNRLPEERSHDHQHAKCGRCGQALFSGKVINATEETLDKLLQDDLPVVVD
FWAPWCGPCVNFAPVFESVADENGGKIRFIKVNTEAEPGLSARFRIRSIPTIMLFKHGKV
VDMLNGAMPKAPFESWLGESL