Protein Info for DDA3937_RS16755 in Dickeya dadantii 3937

Annotation: transcriptional repressor MprA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF01047: MarR" amino acids 53 to 112 (60 residues), 52.6 bits, see alignment E=3.4e-18 PF12802: MarR_2" amino acids 58 to 111 (54 residues), 42.5 bits, see alignment E=6e-15

Best Hits

Swiss-Prot: 73% identical to MPRA_ECOL6: Transcriptional repressor MprA (mprA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03712, MarR family transcriptional regulator (inferred from 100% identity to ddd:Dda3937_00894)

Predicted SEED Role

"Transcription repressor of tripartite multidrug resistance system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCY8 at UniProt or InterPro

Protein Sequence (170 amino acids)

>DDA3937_RS16755 transcriptional repressor MprA (Dickeya dadantii 3937)
MESSFAPIEDMLRMRASRRPDFPYREVLLLRLFLHMQTKILEHRNRMLKEQDINETLFMA
LLTLESQENYCIQPSELSAALGSSRTNATRIADELEKRGWIERRESDSDRRCLYLYMTEK
GKAFLDELLPPQHRSLNILCSALEDSERDQLEVLMRKLLQRLDEMDQDGI