Protein Info for DDA3937_RS16535 in Dickeya dadantii 3937

Annotation: glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01027: glutamate 5-kinase
  • amino acids 5 to 366 (362 residues), 503.4 bits, E=1.9e-155
• PF00696: AA_kinase
  • amino acids 6 to 234 (229 residues), 160.2 bits, E=7e-51
• PF01472: PUA
  • amino acids 276 to 350 (75 residues), 67.3 bits, E=9.3e-23

Best Hits

Swiss-Prot: 92% identical to PROB_PECAS: Glutamate 5-kinase (proB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 100% identity to ddd:Dda3937_00936)

MetaCyc: 87% identical to glutamate 5-kinase (Escherichia coli K-12 substr. MG1655)
Glutamate 5-kinase. [EC: 2.7.2.11]

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11)" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (2/3 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-N^δ-acetylornithine biosynthesis (3/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

See E0SCU3 at UniProt or InterPro

Protein Sequence (367 amino acids)

>DDA3937_RS16535 glutamate 5-kinase (Dickeya dadantii 3937)
MSGSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREHL
GYPELPPTIATKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADLEDRERFLNARDT
MRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAMLADADKLLLLTDQAGLFTADPR
SNPDAELIREVQGVTDELRQIAGGSVSGLGTGGMSTKLQAADVACRSGIDVIIAAGNRTG
VIADVINDVSVGTRFHALETPLESRKRWIFGAPPAGEITVDDGALAAMLERGSSLLPKGI
REVAGNFSRGEVIRIRSLNGRDLAHAVTRYNSDALRMIAGHHSQEIAEILGYEYGPVAVH
RDDMIII