Protein Info for DDA3937_RS16400 in Dickeya dadantii 3937

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 PF00005: ABC_tran" amino acids 37 to 196 (160 residues), 97.5 bits, see alignment E=6.8e-31 amino acids 320 to 468 (149 residues), 106.6 bits, see alignment E=9.9e-34 PF08352: oligo_HPY" amino acids 247 to 278 (32 residues), 22 bits, see alignment (E = 1e-07) amino acids 521 to 549 (29 residues), 18.4 bits, see alignment (E = 1.4e-06)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03187)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCR5 at UniProt or InterPro

Protein Sequence (559 amino acids)

>DDA3937_RS16400 ABC transporter ATP-binding protein (Dickeya dadantii 3937)
MDKHDAILPTTATTPVLAVKDYSLDYALPDGSHLPVLRDITLHVNRGDVVGLVGESGSGK
TTLGWAIMRWLAGNAVERAGDIHLGELNLRTLAMDKLHALRGGKLGMIFQDPSASLNPTL
TLGEQVTEVLRRHRRLNAREAQEYAETLLRDVDLKNPAQMMQRYPHQVSGGEKQRILIAT
AFACQPDCLIFDEPTTALDVISAAQILALFERLREETGVAALYISHDLALVSRVTDRVCV
LEKGRIVEQADARALFSMPQHAYTRRLIAAVPNPSVRLLDETAPSCQPLLTLSDITIQYG
HHRLLDKLLKRQSNQTRAANAVSLTVHEGEIVGIVGESGSGKSTLAKAVTGLVPFSGKLD
FRGYTLFGRTQMDKDYRRRVQMIFQHPDASLNPRMRIGDIIARPLRLYGLPNGETETQAV
ARLLEEVRLPASMASRYPHELSGGQKQRVAIARAFAHPPELVICDEITAALDVSVQATVI
ELLLELRRRYGTAYLFITHDLNLIQQVAHRIAVMYRGDLLEILPGHAMASQAQHPYTQAL
LSAIPTPGDLSPASHSYTE