Protein Info for DDA3937_RS16295 in Dickeya dadantii 3937

Annotation: ankyrin repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13637: Ank_4" amino acids 54 to 104 (51 residues), 32 bits, see alignment E=3.1e-11 amino acids 89 to 137 (49 residues), 37.6 bits, see alignment E=5.1e-13 PF12796: Ank_2" amino acids 55 to 146 (92 residues), 64.6 bits, see alignment E=2.6e-21 PF13857: Ank_5" amino acids 76 to 121 (46 residues), 29.3 bits, see alignment 2.3e-10 PF00023: Ank" amino acids 84 to 115 (32 residues), 30.4 bits, see alignment 8.3e-11 amino acids 117 to 147 (31 residues), 21.1 bits, see alignment 7.4e-08 amino acids 150 to 180 (31 residues), 16.9 bits, see alignment 1.7e-06

Best Hits

KEGG orthology group: K06867, (no description) (inferred from 100% identity to ddd:Dda3937_03165)

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SC86 at UniProt or InterPro

Protein Sequence (197 amino acids)

>DDA3937_RS16295 ankyrin repeat domain-containing protein (Dickeya dadantii 3937)
MKPFRLFLCLLALTLTTAQAQQPTAPVAPPASVSNAPAAPALNERQVQSQLNQYLWDAAR
TGNDAVIQEFINAGYNLNTRDEKGYSAVILAAYHGHYDTVSLLLNHGADPCQQDNRGNTA
LMGAAFKGELKIAHLLLSAKCNPDTRNHAGQTAAMYASLFQRAEILKALQEQGADMNATD
AMGNSVQALGKGEVKGQ