Protein Info for DDA3937_RS16265 in Dickeya dadantii 3937

Annotation: cytochrome b561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 81 to 109 (29 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 5 to 174 (170 residues), 90.6 bits, see alignment E=5.4e-30

Best Hits

Swiss-Prot: 50% identical to C561_YERPE: Probable cytochrome b561 (cybB) from Yersinia pestis

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03159)

MetaCyc: 52% identical to superoxide oxidase (Escherichia coli K-12 substr. MG1655)
RXN-20148 [EC: 1.10.3.17]

Predicted SEED Role

"cytochrome b(561)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.10.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SC80 at UniProt or InterPro

Protein Sequence (177 amino acids)

>DDA3937_RS16265 cytochrome b561 (Dickeya dadantii 3937)
MKTKYHSSQIVLHWLVLLLVIVTYAAMELRGFAPRGSSARALMSTIHYSCGVSVWVLMIL
RVVQRFRHPTPPITPPPGRLLVIASHAVHGFLYLMFLALPVLGVLGMYYRGADWSIFGIA
MPFAAESNEDIKQILLNIHELIANAGYFLVGLHAVAALYHHYVVRDDTLLRMMPDKK