Protein Info for DDA3937_RS16250 in Dickeya dadantii 3937

Annotation: nicotinamide-nucleotide amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02464: CinA
  • amino acids 9 to 159 (151 residues), 202.9 bits, E=1.1e-64
• TIGR00199: amidohydrolase, PncC family
  • amino acids 13 to 160 (148 residues), 194.2 bits, E=6.2e-62

Best Hits

Swiss-Prot: 62% identical to PNCC_ENTAG: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Enterobacter agglomerans

KEGG orthology group: K03743, (no description) (inferred from 100% identity to ddd:Dda3937_03155)

MetaCyc: 61% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

"C-terminal domain of CinA paralog, YdeJ"

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Sequence Analysis Tools

See E0SC76 at UniProt or InterPro

Protein Sequence (162 amino acids)

>DDA3937_RS16250 nicotinamide-nucleotide amidase (Dickeya dadantii 3937)
MTETEILRLSALVGERLKARQEKITCAESCTGGWLAKAITDVPGSSAWFDYGFVTYSNQA
KQALIGVQANTLAQFGAVSRDVVNEMAAGALSRSGADIAVSVSGIAGPDGGTPDKPVGTV
WFGFSDKNGNRVAQKMQFDGDRHDVRLQAVAFALQTLLERFL