Protein Info for DDA3937_RS16230 in Dickeya dadantii 3937

Annotation: carbon storage regulator CsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 61 PF02599: CsrA" amino acids 1 to 52 (52 residues), 94.4 bits, see alignment E=1.6e-31 TIGR00202: carbon storage regulator" amino acids 1 to 58 (58 residues), 106.4 bits, see alignment E=3.1e-35

Best Hits

Swiss-Prot: 100% identical to CSRA_PECCP: Translational regulator CsrA (csrA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03563, carbon storage regulator (inferred from 97% identity to eck:EC55989_2958)

Predicted SEED Role

"Carbon storage regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SC72 at UniProt or InterPro

Protein Sequence (61 amino acids)

>DDA3937_RS16230 carbon storage regulator CsrA (Dickeya dadantii 3937)
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQPTS
Y