Protein Info for DDA3937_RS16200 in Dickeya dadantii 3937

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 65 (25 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details PF09335: SNARE_assoc" amino acids 27 to 132 (106 residues), 42.1 bits, see alignment E=5.7e-15

Best Hits

Swiss-Prot: 52% identical to YQAA_SHIFL: Inner membrane protein YqaA (yqaA) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03149)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SC70 at UniProt or InterPro

Protein Sequence (142 amino acids)

>DDA3937_RS16200 DedA family protein (Dickeya dadantii 3937)
MSEFWAVFSLFWSSFLSATLLPGSSEVVLVSLLLTHSTSPLLLIVIASIGNTLGGITNII
VGRLIPELKPQRGLDTARRWLQRYGTAALLFSWVPVVGDILCVLSGWLRMPWASSVICIF
IGKTLRYLVVAGVALKWTMGTG