Protein Info for DDA3937_RS15940 in Dickeya dadantii 3937

Annotation: tRNA glutamyl-Q(34) synthetase GluQRS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 7 to 267 (261 residues), 369.5 bits, see alignment E=5.1e-115 PF00749: tRNA-synt_1c" amino acids 10 to 235 (226 residues), 150.9 bits, see alignment E=2.1e-48

Best Hits

Swiss-Prot: 73% identical to GLUQ_PECAS: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 100% identity to ddd:Dda3937_00511)

MetaCyc: 71% identical to glutamyl-Q tRNAAsp synthetase (Escherichia coli K-12 substr. MG1655)
2.4.1.M62 [EC: 2.4.1.M62]

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 2.4.1.M62 or 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBL1 at UniProt or InterPro

Protein Sequence (302 amino acids)

>DDA3937_RS15940 tRNA glutamyl-Q(34) synthetase GluQRS (Dickeya dadantii 3937)
MPELRPYVGRFAPSPSGDLHFGSLIAALGSYLQARACRGRWLVRIEDIDPPREVPGAAAR
ILSQLEQHGLLWDGDVAYQSRRHDLYRAVLADLQRQGKCYYCTCSRQRIQQIGGHYDGHC
RDRGLPPNQAALRLRQSQPVLHFHDRLRGQIDADPMLAREDFIIHRRDGLFAYNLAVVVD
DHDQGVTEIVRGADLIEPTVRQLSLYHQLDYPAPAYVHLPLALNSDGNKLSKQNHAPALP
DGDPRAVLAQALIFLRQPLPAHWQDLDRDALLAWAVAHWSLVTVPVEAARTSPEITSAFS
KG