Protein Info for DDA3937_RS15855 in Dickeya dadantii 3937

Annotation: CdaR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF05651: Diacid_rec" amino acids 6 to 138 (133 residues), 167 bits, see alignment E=2.6e-53 PF17853: GGDEF_2" amino acids 147 to 272 (126 residues), 65 bits, see alignment E=1.2e-21 PF13556: HTH_30" amino acids 323 to 380 (58 residues), 81.5 bits, see alignment E=4.6e-27

Best Hits

Swiss-Prot: 84% identical to CDAR_ECOLI: Carbohydrate diacid regulator (cdaR) from Escherichia coli (strain K12)

KEGG orthology group: K02647, carbohydrate diacid regulator (inferred from 100% identity to ddd:Dda3937_02640)

Predicted SEED Role

"Sugar diacid utilization regulator SdaR" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBJ3 at UniProt or InterPro

Protein Sequence (385 amino acids)

>DDA3937_RS15855 CdaR family transcriptional regulator (Dickeya dadantii 3937)
MASYHLNNKLAQEIVARTMKIIDSNINVMDARGRIIGSGDRERIGELHEGALLVLSQGRV
VDIDDAVARHLHGVRPGINLPLKIDGEIIGVIGLTGNPGQLRQYGELVCMTAEMMLEQAR
LLHMLAQDSRLREELVLNLIRTDDLSPALMEWAQRLGIDLNQPRVAAVVEVDSGQLGVDS
AMAELQQLQTLLTTPERNNLIAIVSLTEMVVLKPALNNHGRWDAEEHRRRVDTLLSRMEE
SSRLRVRVALGNYFTGPGSIARSYRTARTTMSVGKQRMPAQRSYFYQDLMLPVLLDSLRG
GWQANELVRPLARLKAMDSNGLLRRTLNAWFRNNVQPGATAKALFVHRNTLEYRLNRISE
LTGLDLGNFDDRLLLYVALQLDEEQ