Protein Info for DDA3937_RS15840 in Dickeya dadantii 3937

Annotation: sulfate ABC transporter permease subunit CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 205 to 230 (26 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 23 to 277 (255 residues), 377.3 bits, see alignment E=4e-117 TIGR00969: sulfate ABC transporter, permease protein" amino acids 24 to 273 (250 residues), 311.5 bits, see alignment E=5.2e-97 PF00528: BPD_transp_1" amino acids 85 to 279 (195 residues), 59.4 bits, see alignment E=2.1e-20

Best Hits

Swiss-Prot: 49% identical to CYSW_ECOL6: Sulfate transport system permease protein CysW (cysW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to ddd:Dda3937_03505)

MetaCyc: 49% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBJ0 at UniProt or InterPro

Protein Sequence (294 amino acids)

>DDA3937_RS15840 sulfate ABC transporter permease subunit CysW (Dickeya dadantii 3937)
MDHSISEPVAVRPSSVKRPVAFYVLTTLAWAVFLLILVLPLIMVVTQGLHNGIGAFWNAI
TEPDAVSALKLTLLATVISVPLNMVFGLAIAWCVTKFEFRGKSLLLALLDLPFSVSPVVT
GLMYVLLFGAQSKLYPFLTEHNLEIVYAVPGIVLATMFVTLPYVARELIPLMEQQGSQEE
EAARLLGANGWQMFWHITLPNVKWALIYGVVLCTARAMGEFGAVSVVSGHIRGLTNTLPL
HIEILYNEYNIVAAFSVAILLLVMSLVVLLLRQWSEAHLSKQQEKQQELAGNEH