Protein Info for DDA3937_RS15755 in Dickeya dadantii 3937

Annotation: sigma-E factor regulatory protein RseB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03888: MucB_RseB" amino acids 27 to 194 (168 residues), 194.5 bits, see alignment E=1.1e-61 PF17188: MucB_RseB_C" amino acids 216 to 310 (95 residues), 91.3 bits, see alignment E=3.7e-30

Best Hits

Swiss-Prot: 57% identical to RSEB_ECOLI: Sigma-E factor regulatory protein RseB (rseB) from Escherichia coli (strain K12)

KEGG orthology group: K03598, sigma-E factor negative regulatory protein RseB (inferred from 100% identity to ddd:Dda3937_03846)

Predicted SEED Role

"Sigma factor RpoE negative regulatory protein RseB precursor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBH7 at UniProt or InterPro

Protein Sequence (316 amino acids)

>DDA3937_RS15755 sigma-E factor regulatory protein RseB (Dickeya dadantii 3937)
MKRSWFAACILLGSLSYSSLAPASDSGALLQQMSSASRSLNYEIYYISVSRQGIESLRYR
HTVQNGETLAELIHLDGPKREVIQRGSDISYFEADAEPFTLSGDHIVDSLPALIFANVER
LSAYYDFIPTGRIRLADRQGDVVRIVSRDGTRFSYIVCLDAESRLPLRVDLLDQNGELLD
QYRAISITVDKTVQLAMKPMDKASQPPLLSIPTTSTANFNWVTEWLPVGVEEVSRSQRPL
PGVTGLAESRLYSDGLFSFSVNISPAGESHPDQNASLGRRTIHTEVRDNREITVIGELPL
ATAKRVADNVIFKAQP