Protein Info for DDA3937_RS15475 in Dickeya dadantii 3937

Annotation: type IV pilus biogenesis/stability protein PilW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 12 to 238 (227 residues), 223.2 bits, see alignment E=1.7e-70 PF13181: TPR_8" amino acids 35 to 68 (34 residues), 14.3 bits, see alignment 1.3e-05 amino acids 139 to 171 (33 residues), 15.8 bits, see alignment 4.4e-06 PF13432: TPR_16" amino acids 116 to 170 (55 residues), 19.5 bits, see alignment E=4.2e-07

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 100% identity to ddd:Dda3937_03703)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SN75 at UniProt or InterPro

Protein Sequence (251 amino acids)

>DDA3937_RS15475 type IV pilus biogenesis/stability protein PilW (Dickeya dadantii 3937)
MKRVLLGKAAALVVGMGLLAGCAQTPSKQVSPAAAQTRLQLGLEYLARNNLDAARDNLQK
AEQLAPDDYRTQLGMALYEQRIGENQAAETRYRRLLRQAPANGGVMNNYGAFLCGLGQYV
AAQRQFAAAAQLPDYHQVADALENAGYCFLNAGRPDEASQWLSRALRYDPARGNRLLAEA
NSRFAAGRYDQARLLLNIYQPLMTASAESLWLQIRFAALAGHHDEVTRYGGLLARSFPQS
KQYQQFLANEY