Protein Info for DDA3937_RS15430 in Dickeya dadantii 3937

Annotation: peptidase M4 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF16485: PLN_propep" amino acids 5 to 46 (42 residues), 75.3 bits, see alignment 3.8e-25 PF01447: Peptidase_M4" amino acids 83 to 168 (86 residues), 107.5 bits, see alignment E=1.3e-34 PF02868: Peptidase_M4_C" amino acids 171 to 338 (168 residues), 171.5 bits, see alignment E=2.2e-54

Best Hits

Swiss-Prot: 75% identical to PRT1_PECCC: Extracellular metalloprotease (prt1) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03712)

Predicted SEED Role

"Extracellular metalloprotease precursor (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SN66 at UniProt or InterPro

Protein Sequence (349 amino acids)

>DDA3937_RS15430 peptidase M4 family protein (Dickeya dadantii 3937)
MQSARNIIPPYILHRIINNGSDEERRCAQQTLMHVQSLMVAPVIHPDEHEEHPAGKIQRD
IYDAEHQQTLPGKRVRVEGQPENGDIAVDEAYTYLGITYDFFWKIFGRNSLDNKGLSLIG
SVHYGKDYQNAFWNGQQMVFGDGDGKIFNRFTIALDVIAHELSHGVVESESNLLYFRQSG
ALNESLADVFGSMVKQYYRNQKVQQADWIIGEGLLADGIDGKGLRSMARPGSAYDDLLLG
TDPQPAHMRDFVNTREDNGGVHLNSGIPNRAFYLAAMALGGYSWEKAGHIWYDTLRDKEL
PQNADFSIFARFTVEHARKRFNEAVADAVLRAWHQVGVDTGVLNEHEQE