Protein Info for DDA3937_RS15425 in Dickeya dadantii 3937

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF13742: tRNA_anti_2" amino acids 11 to 103 (93 residues), 113.7 bits, see alignment E=6e-37 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 12 to 360 (349 residues), 457.4 bits, see alignment E=2.2e-141 PF01336: tRNA_anti-codon" amino acids 31 to 105 (75 residues), 45.6 bits, see alignment E=8.1e-16 PF02601: Exonuc_VII_L" amino acids 127 to 441 (315 residues), 378.6 bits, see alignment E=4.4e-117

Best Hits

Swiss-Prot: 82% identical to EX7L_PECCP: Exodeoxyribonuclease 7 large subunit (xseA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to ddd:Dda3937_03713)

MetaCyc: 73% identical to exodeoxyribonuclease VII subunit XseA (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SN65 at UniProt or InterPro

Protein Sequence (462 amino acids)

>DDA3937_RS15425 exodeoxyribonuclease VII large subunit (Dickeya dadantii 3937)
MSSSLPSSAIFTVSRLNQTVKQLLEGEMGQVWLSGEISNFSQPSSGHWYFTLKDERAQVR
CAMFRTGNRRVTFRPQNGQQVLIRATITLYEPRGDYQLLAESMHPAGDGLLQQQFEQLKQ
RLSAEGLFDQQYKQLLPKPARQVGVITSASGAALHDILHILQRRDPSLPVVIYPTAVQGV
DAPAQIVRAIELANLRQECDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSAVGHE
TDVTIADFVADLRAPTPSAAAELVSRNQLELLRQIQSQRQRLEMAMDYYLAQRQQQFVRL
QHRLHQQHPQLRLARQQTQLIRLRQRLDEAIQLQLRQQTRRQERVVQRLRQHQPQPRLHR
AQQQVQQLRYRMQSALEKQLNQHKQRFGEACSHLEAVSPLATLARGYSVTTAPDGKVMKR
TAQAAKGDILKTRLQDGWVESQITEIQKESTKPRTKRQTKNI