Protein Info for DDA3937_RS15260 in Dickeya dadantii 3937

Annotation: MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 26 (3 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 76 to 390 (315 residues), 258.6 bits, see alignment E=3.6e-81 PF16576: HlyD_D23" amino acids 87 to 309 (223 residues), 54.8 bits, see alignment E=1.2e-18 PF13533: Biotin_lipoyl_2" amino acids 89 to 137 (49 residues), 50.7 bits, see alignment 1.8e-17 PF13437: HlyD_3" amino acids 200 to 301 (102 residues), 38.7 bits, see alignment E=2.1e-13

Best Hits

Swiss-Prot: 89% identical to MDTA_DICZ5: Multidrug resistance protein MdtA (mdtA) from Dickeya zeae (strain Ech586)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 100% identity to ddd:Dda3937_02821)

MetaCyc: 66% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SN33 at UniProt or InterPro

Protein Sequence (414 amino acids)

>DDA3937_RS15260 MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit (Dickeya dadantii 3937)
MNAARLFRFLILAVVIAAAFFAWRYFHPSQPEPANGATSTQQSARQGQGRSGGGRRGSSA
PPPVQAALSSSSSVPYYLSGLGTVTAANTVTVHSRVSGQLMALHFQEGQQVKEGELLAEI
DPRPFVVALTQAQGQLAKDQALLVNARQDLARYQQLSKTSLVSGQQLDTQQSLVRQYEAT
VKSDQGSVASAQLQLDYSRITAPFSGRVGLRQIDIGNYVTSTDNLLVLTQTHPIDAVFTV
PESDIATVLKAQKSGQPVLVEAWDRANQHILSQGRLLSMDNQIDATTGTLKLKARFDNTD
DALFPNQFVNIKMKVDTLQNVVVAPSAAIQMGNEGRFVWVLNDQDQVSKHIVTTGIQYGQ
QTVVSTGLNAGERVVTDGIDRLTEGARVEVLAPAAADAKSTAGTEKRQHKAEKS