Protein Info for DDA3937_RS15230 in Dickeya dadantii 3937

Annotation: TIGR01666 family membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 731 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 43 to 59 (17 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 418 to 435 (18 residues), see Phobius details amino acids 442 to 463 (22 residues), see Phobius details amino acids 468 to 486 (19 residues), see Phobius details amino acids 491 to 508 (18 residues), see Phobius details amino acids 513 to 535 (23 residues), see Phobius details TIGR01666: TIGR01666 family membrane protein" amino acids 12 to 709 (698 residues), 1011 bits, see alignment E=0 TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 12 to 709 (698 residues), 911.7 bits, see alignment E=2.8e-278 PF12805: FUSC-like" amino acids 69 to 347 (279 residues), 345.7 bits, see alignment E=1.7e-107 PF13515: FUSC_2" amino acids 408 to 529 (122 residues), 94.6 bits, see alignment E=5.2e-31

Best Hits

Swiss-Prot: 68% identical to YCCS_ECOLI: Inner membrane protein YccS (yccS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02827)

Predicted SEED Role

"Putative efflux (PET) family inner membrane protein YccS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SN24 at UniProt or InterPro

Protein Sequence (731 amino acids)

>DDA3937_RS15230 TIGR01666 family membrane protein (Dickeya dadantii 3937)
MQLSVSTSLRRVIYNSGWLYNLRILIALSGVAFLPWWLGVPTSTIPLTLGVVAAALTDLD
DRLSGRLFNLLITLACFLVASVSIELLYPHPWLFVVGLAISTWSFILLGSLGQRYATIAF
GALLIAIYTMLGISLYSDWYQQPFLLLLGALWYNLLTLLGHLLFPIRPLQDNLARCYQQL
AHYLETKSNLFDPDIDDTDQPLIDVAMANGQLVDTLNQAKASLLTRLRGDRGQRGTRRTL
HYYFVAQDIHERASSAHIQYEQLRHTLRYSDVPFRFQRLLFMLSRACLKVSQSILLQQKY
QHDYRIERAFSHLDAAIDRLAVQGAETLSIKALRHLLNNLRAIDAQLINIQSEQTLERHN
HHLPAENRLSDDKIAGWSDIRLRLNRHLTPQSSLFRHAVRMSLVLCIGYAIIQLTGLQHG
YWILLTSLFVCQPNYNATRRRLALRIVGTLGGVLIGVPLLYIVPSLEGQLALIVISGVLF
FAFRTVQYAQATLFITLLVLMCFNLLGEGLEVAIPRVVDTLLGCGIAWAAVSFIWPDWKF
RGLPAVINKAMNNNCRYLDAIMVQYHQGKDNGLPYRIARRDAHNSDAELASVVSNMSAEP
HARPNTMENAFRLMCLNHTLLGYISTLGAHREHIRSAETLQLLNDAVCYVDDALHQDNGD
QAALDRELGALKNRIHAQSPEQDSKEQLVLQQVNLIIGLLPELTQLKNQMIAEENRPQEP
MHRHRQQTSAR