Protein Info for DDA3937_RS15190 in Dickeya dadantii 3937

Annotation: sulfurtransferase TusE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03342: sulfur relay protein, TusE/DsrC/DsvC family
  • amino acids 4 to 109 (106 residues), 168.1 bits, E=3.2e-54
• PF04358: DsrC
  • amino acids 5 to 109 (105 residues), 152.8 bits, E=2e-49

Best Hits

Swiss-Prot: 89% identical to TUSE_YERPE: Sulfurtransferase TusE (tusE) from Yersinia pestis

KEGG orthology group: K11179, tRNA 2-thiouridine synthesizing protein E [EC: 2.8.1.-] (inferred from 100% identity to ddd:Dda3937_01699)

MetaCyc: 79% identical to sulfur transfer protein TusE (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-)" in subsystem Sulfate reduction-associated complexes (EC 2.8.1.-)

MetaCyc Pathways

• tRNA-uridine 2-thiolation and selenation (bacteria) (7/11 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

See E0SN16 at UniProt or InterPro

Protein Sequence (109 amino acids)

>DDA3937_RS15190 sulfurtransferase TusE (Dickeya dadantii 3937)
MLVFEDRVIDTDAQGYLKDSSDWQEGMAPMLAEQEGITLTDAHWEVVRFVRAFYLEFNTS
PAIRMLVKAMAQKYGEEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI