Protein Info for DDA3937_RS15190 in Dickeya dadantii 3937
Annotation: sulfurtransferase TusE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 89% identical to TUSE_YERPE: Sulfurtransferase TusE (tusE) from Yersinia pestis
KEGG orthology group: K11179, tRNA 2-thiouridine synthesizing protein E [EC: 2.8.1.-] (inferred from 100% identity to ddd:Dda3937_01699)MetaCyc: 79% identical to sulfur transfer protein TusE (Escherichia coli K-12 substr. MG1655)
2.8.1.-
Predicted SEED Role
"tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-)" in subsystem Sulfate reduction-associated complexes (EC 2.8.1.-)
MetaCyc Pathways
- tRNA-uridine 2-thiolation and selenation (bacteria) (7/11 steps found)
Isozymes
Compare fitness of predicted isozymes for: 2.8.1.-
Use Curated BLAST to search for 2.8.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E0SN16 at UniProt or InterPro
Protein Sequence (109 amino acids)
>DDA3937_RS15190 sulfurtransferase TusE (Dickeya dadantii 3937) MLVFEDRVIDTDAQGYLKDSSDWQEGMAPMLAEQEGITLTDAHWEVVRFVRAFYLEFNTS PAIRMLVKAMAQKYGEEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI