Protein Info for DDA3937_RS15000 in Dickeya dadantii 3937

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00005: ABC_tran" amino acids 26 to 165 (140 residues), 116.7 bits, see alignment E=6.5e-38

Best Hits

Swiss-Prot: 54% identical to Y412_METJA: Uncharacterized ABC transporter ATP-binding protein MJ0412 (MJ0412) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to ddd:Dda3937_01662)

Predicted SEED Role

"ABC transporter ATP-binding protein with unknown substrate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SM86 at UniProt or InterPro

Protein Sequence (261 amino acids)

>DDA3937_RS15000 ABC transporter ATP-binding protein (Dickeya dadantii 3937)
MKYSKLTIRQVERVFAGPHGEAIAALQPIDYQVHENDFVTILGPSGCGKSTLLRIIAGLD
TPTRGEVWLDGALVDGPGADRGMVFQSYTLFPWLTVRENICFGLQERGISKAQQRERSDY
YLHQVGLHGFEHHYPRQLSGGMQQRTAIARALANDPKVLLMDEPFGALDNQTRVMMQELL
LSVWESSRKTVLFVTHDIDEAIFMANKVAIFSARPGRIKTEVAVDFPWPRDYTLKTSPEF
MALKARVTEEIRSETLQALAH