Protein Info for DDA3937_RS14935 in Dickeya dadantii 3937

Annotation: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 127.7 bits, see alignment E=7.7e-41 PF17912: OB_MalK" amino acids 235 to 288 (54 residues), 47.7 bits, see alignment 3.7e-16 PF08402: TOBE_2" amino acids 281 to 352 (72 residues), 27.3 bits, see alignment E=4.8e-10

Best Hits

Swiss-Prot: 61% identical to LACK_RHIRD: Lactose transport ATP-binding protein LacK (lacK) from Rhizobium radiobacter

KEGG orthology group: K10111, maltose/maltodextrin transport system ATP-binding protein [EC: 3.6.3.19] (inferred from 100% identity to ddd:Dda3937_02388)

Predicted SEED Role

"Maltose/maltodextrin transport ATP-binding protein MalK (EC 3.6.3.19)" in subsystem Maltose and Maltodextrin Utilization (EC 3.6.3.19)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.19

Use Curated BLAST to search for 3.6.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SM69 at UniProt or InterPro

Protein Sequence (369 amino acids)

>DDA3937_RS14935 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC (Dickeya dadantii 3937)
MSSICLKNVTKRFGKTETLHNINLDIQAGEFAVFVGPSGCGKSTLLRMIAGLEEISDGKI
LIDDEVMNDVAPAHRGVAMVFQSYALYPHMTVAENMGYGLKVNKVPKAEIRHQVEMVAKT
LQLSHLLDRKPKQLSGGQRQRVAIGRAIVRNPKVFMFDEPLSNLDAELRVDMRLHIAKLH
QELKTTMVYVTHDQVEAMTLADKIVVMNNGKVEQTGSPMTLYYNPVNRFVAGFIGSPKMN
FLPATVVSWQPHQLTVTLTAEKTLTLDIDTTPLQPGDAVTLGIRPEHLGIQSSHQATLAF
QCEVVERLGNNTYLFGQCYGYDGVKILLPGDVQFRPWQAITVGFNAAHCLVFNAEGLRIN
ADAPVPGMH