Protein Info for DDA3937_RS14925 in Dickeya dadantii 3937

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 136 to 164 (29 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 220 to 425 (206 residues), 79.2 bits, see alignment E=1.7e-26

Best Hits

Swiss-Prot: 65% identical to GANP_BACSU: Putative arabinogalactan oligomer transport system permease protein GanP (ganP) from Bacillus subtilis (strain 168)

KEGG orthology group: K10109, maltose/maltodextrin transport system permease protein (inferred from 100% identity to ddd:Dda3937_02390)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SM67 at UniProt or InterPro

Protein Sequence (435 amino acids)

>DDA3937_RS14925 sugar ABC transporter permease (Dickeya dadantii 3937)
MIISSGEPLSGEKRTRRHAWVAALCAVLPGGGQFYHRQWAKGMIFLVLLGSYLGVFHDFL
RTGLWGVYTLGEEVPRDNSIFLLAEGIISLLIIAFGVLIYAVSINDAWRNGKRRDDGLTL
NSVRQQYRLLLSEGFPYLMITPGFILLVFVVIFPILFGFAIAFTNYNLYHTPPAKLVEWV
GMKNFVSIFTLSIWRSTFFDVLQWTVVWTLLATTLQCTVGVLLAILVNQKDLRFKPLVRT
IFILPWAVPGFVTILVFAGMFNDSFGVINNAILASVGISPKAWLTDPFWTKTALIMMQTW
LGFPFVFAMTTGVLQAIPDDLYEAATMDGASRWTQLRTITLPLVLYSIAPIIITQYTFNF
NNFNIIYLFNNGGPAVAGSNAGGTDILVSWIYKLTMSSSQYAIAATITILLSIFVVGLAL
WQFRATRSFKNDEMA