Protein Info for DDA3937_RS14920 in Dickeya dadantii 3937

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 117 to 290 (174 residues), 66.7 bits, see alignment E=1.1e-22

Best Hits

Swiss-Prot: 66% identical to GANQ_BACSU: Putative arabinogalactan oligomer transport system permease protein GanQ (ganQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K10110, maltose/maltodextrin transport system permease protein (inferred from 100% identity to ddd:Dda3937_02391)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SM66 at UniProt or InterPro

Protein Sequence (298 amino acids)

>DDA3937_RS14920 sugar ABC transporter permease (Dickeya dadantii 3937)
MATTQGINRQRVNRQGVNRQSIKREKAIRLSLSWLVIIAVSVVIIYPLVWTVGASLNAGN
SLLSTSIIPDNPSFQHYADLFNGQVNYLTWYWNSMKISFLTMVLTLLSVSFTAYAFSRFR
FKGRQNGLMLFLLLQMIPQFSALIAIFVLSQLLGLINSHLALVLIYVAGMIPMNTYLMKG
YLDAIPRELDESARMDGAGNFRIFIEIIIPLSKPIIAVVALFSFTGPLGDFILSSTILRT
PDKYTLPIGLYNLVAQKMGASYTTYAAGAVLIAVPIALLYLMLQKYFVSGLTSGSTKG