Protein Info for DDA3937_RS14905 in Dickeya dadantii 3937

Annotation: PTS transporter subunit EIIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00826: PTS system, glucose-like IIB component
  • amino acids 31 to 86 (56 residues), 48.8 bits, E=3.6e-17
• PF00367: PTS_EIIB
  • amino acids 31 to 62 (32 residues), 49.1 bits, E=1.6e-17

Best Hits

KEGG orthology group: K02778, PTS system, glucose-specific IIB component [EC: 2.7.1.69] (inferred from 93% identity to dze:Dd1591_1281)

Predicted SEED Role

"PTS system, glucose-specific IIBC component (EC 2.7.1.69)" (EC 2.7.1.69)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (104 amino acids)

>DDA3937_RS14905 PTS transporter subunit EIIB (Dickeya dadantii 3937)
MVNLRSFMRYFSHPKPTPELSDDDKQQIQRLLRWFGGRDNIEQVDACITRLRVTVKNLNL
VDSQGLQQEGALGVIILGQQVHAIFGKQSDTLRKLLEDHFSRPE