Protein Info for DDA3937_RS14830 in Dickeya dadantii 3937

Annotation: D-amino-acid transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF01063: Aminotran_4" amino acids 32 to 256 (225 residues), 177.7 bits, see alignment E=1.7e-56

Best Hits

Swiss-Prot: 39% identical to DAAA_STAHA: D-alanine aminotransferase (dat) from Staphylococcus haemolyticus

KEGG orthology group: K00824, D-alanine transaminase [EC: 2.6.1.21] (inferred from 100% identity to ddd:Dda3937_02409)

MetaCyc: 37% identical to D-alanine aminotransferase monomer (Lysinibacillus sphaericus)
D-amino-acid transaminase. [EC: 2.6.1.21]

Predicted SEED Role

"D-alanine aminotransferase (EC 2.6.1.21)" in subsystem Pyruvate Alanine Serine Interconversions (EC 2.6.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.21

Use Curated BLAST to search for 2.6.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SM47 at UniProt or InterPro

Protein Sequence (286 amino acids)

>DDA3937_RS14830 D-amino-acid transaminase (Dickeya dadantii 3937)
MQRSVYVDGQYLPESQATVSVFDRGFLFADAVYEVTSVINGGLVDLDAHLVRLQRSCREL
SLSLPVSIDELTTIHQQLIERNHLQEGSIYLQLSRGNGGDRDFYFPSAEVRPTLVLFTQD
RPIINHPKAETGLSVVTCPDIRWHRRDIKTVSLLAACLAKEYAHAHQADDALLVENGFVT
EGTSCNCYIVLENGTVVTRPLSHDILHGITRQSLLKLAEQQHIAVEERPFTPEEAWQARE
IFITSATSLVLPVVQIDGRQVGDGKPGPITRCLRDIYIEMAHAQTR