Protein Info for DDA3937_RS14800 in Dickeya dadantii 3937

Annotation: type II secretion system secretin GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 710 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 33 to 102 (70 residues), 88.9 bits, see alignment E=2.3e-29 TIGR02517: type II secretion system protein D" amino acids 33 to 655 (623 residues), 575.4 bits, see alignment E=7e-177 PF03958: Secretin_N" amino acids 129 to 190 (62 residues), 54.2 bits, see alignment 2e-18 amino acids 195 to 262 (68 residues), 58.9 bits, see alignment E=6.8e-20 amino acids 269 to 399 (131 residues), 60.6 bits, see alignment E=2.1e-20 PF00263: Secretin" amino acids 483 to 648 (166 residues), 166.7 bits, see alignment E=5.4e-53

Best Hits

Swiss-Prot: 100% identical to GSPD2_DICD3: Secretin OutD (outD) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 100% identity to ddd:Dda3937_02415)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q01565 at UniProt or InterPro

Protein Sequence (710 amino acids)

>DDA3937_RS14800 type II secretion system secretin GspD (Dickeya dadantii 3937)
MLGKGIKKSWGWLGLTVLLLGSPCGWAAEFSASFKGTDIQEFINTVSKNLNKTVIIDPTV
RGTISVRSYDMMNEGQYYQFFLSVLDVYGFSVVPMDNGVLKVIRSKDAKSSSIPLANNEQ
PGIGDELVTRVVPLNNVAARDLAPLLRQLNDNAGAGTVVHYEPSNVLLMTGRAAVIKRLV
DIVNTVDKTGDREMVTVPLTYASAEDVAKLVNDLNKSDEKNALPSTMLANVVADGRTNSV
VVSGEENARQRAVEMIRQLDRKQVVQGGTKVIYLKYAKALDLIEVLAGNGTSGNRNSSSS
NASRPSSPRSGSSSNSNSSSGSSGSSSGSSSSSSSSSSMGFGSAFGSTSSSGGRTITIQG
KEVTVRAHDQTNSLIITAPPDIMRDLEQVINQLDIRRPQVLVEAIIAEIQDADGLNLGIQ
WANKRAGMTQFTNTGIPISTAVIGTDQFRSNGTLTTAYASALSSFNGVTAGFYRGNWSML
LTALSSDSKNDVLATPSIVTLDNMEATFNVGQEVPVLTGSQTTSADNIFNTVERKTVGIK
LRVKPQINEGDSVLLQIEQEVSSVADSNSSTNSSLGVTFNTRTVNNAVMVTNGETVVVGG
LLDKTSVESNDKVPLLGDIPWLGSLFRSKSQEVRKRNLMLFLRPTIIRDPGQFQEASINK
YRSFNNEQQQQRGEGNGVLDNNTLRLSGGNTYTFRQVQSSISDFYKPEGR