Protein Info for DDA3937_RS14775 in Dickeya dadantii 3937

Annotation: type II secretion system minor pseudopilin GspI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF07963: N_methyl" amino acids 1 to 25 (25 residues), 30.4 bits, see alignment 2.1e-11 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 3 to 24 (22 residues), 25.4 bits, see alignment 8.8e-10 TIGR01707: type II secretion system protein I" amino acids 5 to 104 (100 residues), 93.4 bits, see alignment E=1e-30 PF02501: T2SSI" amino acids 39 to 116 (78 residues), 87.8 bits, see alignment E=4.1e-29

Best Hits

Swiss-Prot: 94% identical to GSPI_DICCH: Type II secretion system protein I (outI) from Dickeya chrysanthemi

KEGG orthology group: K02458, general secretion pathway protein I (inferred from 100% identity to ddd:Dda3937_02420)

Predicted SEED Role

"General secretion pathway protein I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SLF9 at UniProt or InterPro

Protein Sequence (125 amino acids)

>DDA3937_RS14775 type II secretion system minor pseudopilin GspI (Dickeya dadantii 3937)
MKQQGMTLLEVMVALVIFALAGLTVLKTTAQQANGLGRLEEKTFALWIAENQQAAMRLEK
QWPQTQWVDGEVNFAGSVWFWRIQGVATADTQVRAIDVEVRHERDSRAADAILRSYQVQP
GEPAQ