Protein Info for DDA3937_RS14715 in Dickeya dadantii 3937

Annotation: isochorismatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF00857: Isochorismatase" amino acids 32 to 205 (174 residues), 145.5 bits, see alignment E=1.9e-46 PF00550: PP-binding" amino acids 221 to 278 (58 residues), 37.4 bits, see alignment E=2.4e-13

Best Hits

Swiss-Prot: 67% identical to ENTB_ECO57: Enterobactin synthase component B (entB) from Escherichia coli O157:H7

KEGG orthology group: K01252, enterobactin isochorismatase [EC: 3.3.2.1] (inferred from 100% identity to ddd:Dda3937_02432)

MetaCyc: 67% identical to enterobactin synthase component B (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1) [enterobactin] siderophore / Apo-aryl carrier domain of EntB" in subsystem Siderophore Enterobactin (EC 3.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SLE5 at UniProt or InterPro

Protein Sequence (291 amino acids)

>DDA3937_RS14715 isochorismatase (Dickeya dadantii 3937)
MAIPKLNAYPLPGVEHLPVNKVNWPVDPTRAALLIHDMQNYFLNFWGENSPLTEQLIANV
ARIRQACRQQGIPVFYTAQPNQQSDADRALLNDMWGPGLNRHPEQQQITAALTPNADDTV
LVKWRYSAFHRSDLEQRLNAAGRDQLIICGVYAHIGCLTTATDAFMRNIKPFMIADALAD
FSQEEHLMALRYTAGRCGRVLTSEQLLDALAPQTDDGLARLRAELLPLLDDDDEIGDDDN
LLDYGLDSVRIMSLVTRWRQQGHDLDFVALVKNPTLRHWHQLLSQPQREEA