Protein Info for DDA3937_RS14695 in Dickeya dadantii 3937

Annotation: enterochelin esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF11806: Enterochelin_N" amino acids 45 to 171 (127 residues), 146.8 bits, see alignment E=5e-47 PF00756: Esterase" amino acids 215 to 422 (208 residues), 76.7 bits, see alignment E=2.5e-25

Best Hits

Swiss-Prot: 100% identical to FES_DICD3: Enterochelin esterase (fes) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03040)

Predicted SEED Role

"Enterobactin esterase" in subsystem Siderophore Enterobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O51900 at UniProt or InterPro

Protein Sequence (435 amino acids)

>DDA3937_RS14695 enterochelin esterase (Dickeya dadantii 3937)
MPAAQPSGFVATLLSSPQAGEEAWWQQVARLGTPLVEAQDSGRVRMTFLWRDPDGDERYS
AIRRVYADINGVTDHHSTDPQSLERLPGTDVWHWSMAIEHDWRGSYSLIPIVAAQLPPVF
SDDGQLRDEQQREWWCSLFPCAIADPLNRDQSWGEQLSAAHMPAAPSQQAWRAVDNGTAL
PPDAARLTVLDWKSEQLDNQRRIWLYTTGISDEPAQRPLCIVLDGQKWAEETPLFAALEA
ETAAGHLPPAVWLFIDAIDGETRCRELPCDAAFWLAVQDELLPQAARLAPFSDDPDRTVV
SGQSYGGLAALYAGLHWPQRFGRVLTQSGSFWWPNLQFITDFDQRDTLEPGVLVTEVRQG
GQTAWPLVIFQEAGRREADIAFVNQQMHEALVAAGHQVHQRVYAGGHDTLCWRGGLIDGF
RWLLTGDDPQAASRD