Protein Info for DDA3937_RS14675 in Dickeya dadantii 3937

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 21 to 169 (149 residues), 107.8 bits, E=1.1e-34

Best Hits

Swiss-Prot: 60% identical to FEPC_ECOLI: Ferric enterobactin transport ATP-binding protein FepC (fepC) from Escherichia coli (strain K12)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to ddd:Dda3937_03036)

MetaCyc: 60% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Ferric enterobactin transport ATP-binding protein FepC (TC 3.A.1.14.2)" in subsystem Siderophore Enterobactin (TC 3.A.1.14.2)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.17

Sequence Analysis Tools

See E0SLD6 at UniProt or InterPro

Protein Sequence (265 amino acids)

>DDA3937_RS14675 ABC transporter ATP-binding protein (Dickeya dadantii 3937)
MTHLLHAEQLTLGYDNKIIARDLSVAIPAGKFSVIIGPNACGKSTLLRALCRLLKPMAGD
VLLDGTSIHRIPTKTLARRLGLLPQHTIVPDNITVMDLVARGRYPHQTLLRQWSDADQTA
VEQAMAATNVSELAERSVDELSGGQRQRVWIAMVLAQQTPLLLLDEPTTWLDIAHQIDLL
DLFRELNQQHDRTLVAVLHDLNQACRYADHLIVMRAGAVMAQGVPADIITAELVQEVFGM
ACVIIDDPVSHTPLIVPCGRHHPAP