Protein Info for DDA3937_RS14660 in Dickeya dadantii 3937

Annotation: enterobactin transporter EntS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 111 to 139 (29 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 217 to 242 (26 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 358 to 375 (18 residues), see Phobius details amino acids 380 to 399 (20 residues), see Phobius details PF05977: MFS_3" amino acids 16 to 404 (389 residues), 103.6 bits, see alignment E=1e-33 PF07690: MFS_1" amino acids 22 to 353 (332 residues), 109.8 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 51% identical to ENTS_CITK8: Enterobactin exporter EntS (entS) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K08225, MFS transporter, ENTS family, enterobactin (siderophore) exporter (inferred from 100% identity to ddd:Dda3937_03033)

MetaCyc: 50% identical to enterobactin exporter EntS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-496

Predicted SEED Role

"Enterobactin exporter EntS" in subsystem Siderophore Enterobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SLD2 at UniProt or InterPro

Protein Sequence (426 amino acids)

>DDA3937_RS14660 enterobactin transporter EntS (Dickeya dadantii 3937)
MAKSSFFLDFSLLKQNAHFRAIFVARMLSVFALGMLTVGVPVQIQAMTGSTLQVGMAVAL
DGIGMFIGLMLGGVLADRFDRRKLILFARGTCGLGFVALSLNAFSGSPSLLALYVLAAWD
GFFGALGMTALMAVIPLLVGRENLPAAGALTMLTVRLGAILSPALGGVIIVAGGVGWNFA
VAAAGTLATLIPLVRLPSMKPAPGKPEHPLQALAGGVRFVCAHPVVGCVVLLGMLVSVVG
AMRVLFPALAGDAYHAGPSAVGLMYSAVPLGAMIGAFTSGWVSGVQRPGKILLGCATGAF
LAVASLGLFSHLLPALLALVCYGYFNAITSLLQFTLIQSHTPDHLLGRVNSLGTAQDVTG
DSVGALILGLMGKLLTPATSILAFGAAAALLGGVIALLVRPLRQCRFGEPAASPDEEETG
DAVHEG