Protein Info for DDA3937_RS14475 in Dickeya dadantii 3937

Annotation: 4-phosphoerythronate dehydrogenase PdxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF00389: 2-Hacid_dh" amino acids 10 to 279 (270 residues), 64.4 bits, see alignment E=1.4e-21 PF02826: 2-Hacid_dh_C" amino acids 110 to 246 (137 residues), 109.2 bits, see alignment E=2.5e-35 PF11890: DUF3410" amino acids 289 to 369 (81 residues), 99.6 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 80% identical to PDXB_PECCP: Erythronate-4-phosphate dehydrogenase (pdxB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03473, erythronate-4-phosphate dehydrogenase [EC: 1.1.1.290] (inferred from 100% identity to ddd:Dda3937_02107)

MetaCyc: 75% identical to erythronate-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
4-phosphoerythronate dehydrogenase. [EC: 1.1.1.290]

Predicted SEED Role

"Erythronate-4-phosphate dehydrogenase (EC 1.1.1.290)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.290)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.290

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SL93 at UniProt or InterPro

Protein Sequence (377 amino acids)

>DDA3937_RS14475 4-phosphoerythronate dehydrogenase PdxB (Dickeya dadantii 3937)
MKILVDENMPYAQMLFSRLGEVTAVPGRPIPTDALNGADALMVRSVTKVNADLLTGKAVK
FVGTATAGTDHVDEAFLRQQGIAFSAAPGCNAIAVVEYVFSALLMLAERDGFALTDRTVG
IIGVGNVGSRLNDRLTALGVRTLLCDPPRADRGDSGSFLSLDEVVEQADVLTFHTPLLKD
GPYATWHSVNAALLARLKDGAILINACRGPVVDNAALLAALQGGQNISVVLDVWEPEPEL
SIELLDRVDIGTAHIAGYTLEGKARGTTQVFEAWSRFIGQPQQVALSSLLPVPELAEITL
TVPLDEHQLKRLVHLVYDVRRDDALLRQVAHLPGEFDRLRKFYQERREWSSLHVVCADRE
SADRLNRLGFTASVNDH