Protein Info for DDA3937_RS14410 in Dickeya dadantii 3937

Annotation: histidine ABC transporter ATP-binding protein HisP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00005: ABC_tran" amino acids 21 to 181 (161 residues), 127.2 bits, see alignment E=1.1e-40 PF13304: AAA_21" amino acids 152 to 213 (62 residues), 27 bits, see alignment E=7.1e-10

Best Hits

Swiss-Prot: 84% identical to HISP_SALTY: Histidine transport ATP-binding protein HisP (hisP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10017, histidine transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 99% identity to dze:Dd1591_1379)

Predicted SEED Role

"Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SKK3 at UniProt or InterPro

Protein Sequence (257 amino acids)

>DDA3937_RS14410 histidine ABC transporter ATP-binding protein HisP (Dickeya dadantii 3937)
MQNNKLMVTELRKRYGQHEVLKGISLQAKAGDVISIIGSSGSGKSTLLRCINFLEKPCEG
SIHVNGQEIHMVRDKDGQLKVFDKKQLQLLRTRLTMVFQHFNLWSFMTALENVMEAPVQV
LGLSKAEARKRAEFYLNKVGITGASQEKYPADLSGGQQQRVSIARALAMEPDVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMEFARHVSSHVIFLHQGLVEEEGPPEAVF
GNPQSPRLQQFLSGALK