Protein Info for DDA3937_RS14355 in Dickeya dadantii 3937

Annotation: SLC13 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 51 (23 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 96 to 123 (28 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 174 to 200 (27 residues), see Phobius details amino acids 426 to 451 (26 residues), see Phobius details amino acids 468 to 488 (21 residues), see Phobius details amino acids 508 to 537 (30 residues), see Phobius details amino acids 549 to 569 (21 residues), see Phobius details amino acids 589 to 609 (21 residues), see Phobius details PF03600: CitMHS" amino acids 17 to 555 (539 residues), 308.3 bits, see alignment E=1.3e-95 PF02080: TrkA_C" amino acids 233 to 298 (66 residues), 36.9 bits, see alignment E=5.6e-13 amino acids 327 to 393 (67 residues), 47.8 bits, see alignment E=2.1e-16 PF00939: Na_sulph_symp" amino acids 423 to 605 (183 residues), 44.5 bits, see alignment E=2.3e-15 PF06808: DctM" amino acids 424 to 604 (181 residues), 32.4 bits, see alignment E=9.2e-12

Best Hits

Swiss-Prot: 73% identical to YFBS_ECOLI: Uncharacterized transporter YfbS (yfbS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_04025)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SKJ0 at UniProt or InterPro

Protein Sequence (611 amino acids)

>DDA3937_RS14355 SLC13 family permease (Dickeya dadantii 3937)
MLSSSLVWVVMLLLIAIVLFATGKLRMDVIALLVIVAFVLSGTLTLQEALIGFSDPNVFL
IAALFVIGEGLVRTGVAYQVGDWLMRVAGQSETRMLILLMCTVALLGAFMSSTGVVAIFI
PVVLNVAARMKTTPARLMMPLAFAGLISGMMTLVATPPNMVVSSELMRTGMAGFSFFSVT
PIGVVVLLIGIAYMLVARFWLTVTDSDNPKEGWKRKTFRDLIREYRLTGRARRLAIRTGS
PLIGQRLDDLQLRQRYGANVVGIERWQKFRRIMVSVSGNSELRLNDVLLIDMSASDVDLR
EFCATQRLEPMVLRGEYFSEQARDVGMAEVSLIPDSGLLGKTLQEASFRSRYGLTVVGIR
RDGEALEGTLADEALKLGDILLVIGDWKNIRLLHQHKHHFIVLNLPAEVDEVAPASNQAP
HALFCLALMVAMMLTDEIPNAIAALIACLLMGQFRCIDMESAYRAVHWPSLILIVGMMPF
ALALQQTGGVALVVKGLMEIGGDAGPHMMLVCLFLLCALTGLFISNTATAVLMAPIAVAA
AEQMQVSPYPFAMIIAIAASAAFMTPVSSPVNTLVLAPGGYRFSDFVRVGVPFTLLVMGV
SVVMVPWLYPF