Protein Info for DDA3937_RS14330 in Dickeya dadantii 3937

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 45 to 182 (138 residues), 223.9 bits, E=3.7e-71
• PF01058: Oxidored_q6
  • amino acids 67 to 174 (108 residues), 89.5 bits, E=7.7e-30

Best Hits

Swiss-Prot: 92% identical to NUOB_CROS8: NADH-quinone oxidoreductase subunit B (nuoB) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 100% identity to dze:Dd1591_1395)

MetaCyc: 88% identical to NADH:quinone oxidoreductase subunit B (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NAD(P)/NADPH interconversion (4/6 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See E0SKI3 at UniProt or InterPro

Protein Sequence (224 amino acids)

>DDA3937_RS14330 NADH-quinone oxidoreductase subunit B (Dickeya dadantii 3937)
MDYTLTRIDPDGENDRYPLQKQEIVSDPLEQHVNRSVFMGNLEQSLHSMVNWGRSNSLWP
YNFGLSCCYVEMATSFTSVHDVARFGSEVIRASPRQADFMVVAGTPFLKMAPVIQRLYDQ
MLAPKWVISMGACANSGGMYDIYSVVQGVDKFLPVDVYIPGCPPRPEAYMQALLLLKESI
GKERRPLSWVVGDQGVYRANMQSERERKRGERIAVTNLRSPDEI