Protein Info for DDA3937_RS14315 in Dickeya dadantii 3937

Annotation: NADH-quinone oxidoreductase subunit NuoF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01959: NADH oxidoreductase (quinone), F subunit
  • amino acids 14 to 426 (413 residues), 666.1 bits, E=6.6e-205
• PF01512: Complex1_51K
  • amino acids 55 to 227 (173 residues), 173.1 bits, E=4e-55
• PF10589: NADH_4Fe-4S
  • amino acids 341 to 424 (84 residues), 97.5 bits, E=3.4e-32

Best Hits

Swiss-Prot: 90% identical to NUOF_ECOLI: NADH-quinone oxidoreductase subunit F (nuoF) from Escherichia coli (strain K12)

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 99% identity to dze:Dd1591_1398)

MetaCyc: 90% identical to NADH:quinone oxidoreductase subunit F (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NAD(P)/NADPH interconversion (4/6 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See E0SKI0 at UniProt or InterPro

Protein Sequence (449 amino acids)

>DDA3937_RS14315 NADH-quinone oxidoreductase subunit NuoF (Dickeya dadantii 3937)
MSKNIVLTAEQHPLTWRLRADKQPVWLDEYRSKNGYAGAQKALTGMAQDEVVTLVKDAGL
RGRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRLLMEQMPHLLVEGMLIG
AYALKAYRGYIFLRGEYVEAAANLRRAIAEATEAGLLGKNIMGTGFNFELFVHTGAGRYI
CGEETALINSLEGRRANPRSKPPFPASAGAWGKPTCVNNVETLCNVPAIIEHGVEWYQGL
SAGKSKDAGTKLMGFSGRVKNPGLWELPFGTTAREILEDYAGGMRDGLTLKAWQPGGAGT
DFLTDAHLDLPMDFENIGKAGSRLGTALAMAVDNEINMVSLTRNLEEFFARESCGWCTPC
RDGLPWSVKILRALERGEGQPGDIETLEQLCRFLGPGNTFCAHAPGAVEPLQSAIKYFRD
EFEAGIARQVVSNAKPIGGIQPNLLKQRW