Protein Info for DDA3937_RS14255 in Dickeya dadantii 3937

Annotation: hydrogenase 2 small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 336 to 356 (21 residues), see Phobius details TIGR00391: hydrogenase (NiFe) small subunit (hydA)" amino acids 7 to 365 (359 residues), 569.8 bits, see alignment E=2.6e-175 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 13 to 31 (19 residues), 21.5 bits, see alignment (E = 2.3e-08) PF01058: Oxidored_q6" amino acids 59 to 204 (146 residues), 104.9 bits, see alignment E=2.6e-34 PF14720: NiFe_hyd_SSU_C" amino acids 224 to 306 (83 residues), 89.9 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 82% identical to MBHT_ECO57: Hydrogenase-2 small chain (hybO) from Escherichia coli O157:H7

KEGG orthology group: K06282, hydrogenase small subunit [EC: 1.12.99.6] (inferred from 98% identity to dze:Dd1591_1410)

MetaCyc: 82% identical to hydrogenase 2 small subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Uptake hydrogenase small subunit precursor (EC 1.12.99.6)" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase (EC 1.12.99.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.99.6

Use Curated BLAST to search for 1.12.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SKG7 at UniProt or InterPro

Protein Sequence (375 amino acids)

>DDA3937_RS14255 hydrogenase 2 small subunit (Dickeya dadantii 3937)
MNGENMMLSHHGINRRDFMKLCAALAATMGLKEAAAAEMAQSLTSPQRPPVIWIGAQECT
GCTESLLRATHPTIENLLLNTISLEYHEVLSAAFGEQAEENKHRAIEQYKGKYVLVVDGS
IPLKDGGIYCMVAGKPIVEHIRAAAEHAAAIVAIGSCSAWGGVPASGSNPTGAASLQAVL
PGKTVINIPGCPPNPHNFLATVAHIITYQRAPALDSQNRPTFAYARLIHENCERRPHFDA
GRFAKEFGDEGHRQGWCLYHLGCKGPETYGNCPTLEFCDVGGGIWPVGIGHPCYGCNEEG
IGFTKGIFQLANVENPTPRVEKPAVTSPEGGNSSATATGLIGGVLGAVAGVSLMAVRELG
RQQKQQDAGNASREG