Protein Info for DDA3937_RS14225 in Dickeya dadantii 3937

Annotation: hydrogenase maturation nickel metallochaperone HypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01155: HypA
  • amino acids 1 to 111 (111 residues), 114.3 bits, E=1.5e-37
• TIGR00100: hydrogenase nickel insertion protein HypA
  • amino acids 1 to 113 (113 residues), 133.1 bits, E=2.4e-43

Best Hits

Swiss-Prot: 61% identical to HYBF_SALTY: Hydrogenase maturation factor HybF (hybF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 100% identity to ddd:Dda3937_01819)

MetaCyc: 52% identical to hydrogenase 3 nickel incorporation protein HypA (Escherichia coli K-12 substr. MG1655)
RXN-22650

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HypA" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

• NiFe(CO)(CN)₂ cofactor biosynthesis (7/10 steps found)

Sequence Analysis Tools

See E0SKG1 at UniProt or InterPro

Protein Sequence (113 amino acids)

>DDA3937_RS14225 hydrogenase maturation nickel metallochaperone HypA (Dickeya dadantii 3937)
MHEISMCYNALELIEQQARQHGAQRVTGVWLEIGALSCIEESALRFCFESVCRQTLAEGC
QLHLSVHPAQAWCWECSQPVEVADHDSGCPHCGSHSLRVESGDSLQLKQLAIE